The lobster and the wise guy vaudeville act and monologueSimilarSacco-Vanzetti Case Records, 1920-1928. Defense Papers. Stenographic Record: Commonwealth v. Sacco and Vanzetti before J. Thayer. Arguments re: Sacco's state of mind. Witnesses: Albert C. Crocker, Dr. Charles Mcfie Campbell, Dr. James V. May, Dr. Elisha H. Cohcon, Dr. Albert C. Thomas, Dr. Abraham Myerson, Fred H. Moore. Contains argument of Mr. Hill, April 18, 1923. Box 6, Folder 21, Harvard Law School Library, Historical & Special CollectionsGeneral Correspondence: Brewer, Griffith, 1937The wild flower fairy bookBébée; or, Two little wooden shoes;The dragon and juggernaut of speculation as exemplified in gambling in prices of our food products. Writen especially for the education and protection of our young men and women, about to enter the business or professional world; and a warning to our produce growers and provision packers. Tricks of the manipulator exposed, how speculators are also buncoed and fleecedThe creative performer TV script, Ford Presents, 1960 Jan. 31MoreRelatedThe lobster and the wise guy vaudeville act and monologueThe lobster and the wise guy vaudeville act and monologueFisher and Carroll in a slap-bang absurdity, The LobsterPlays and monologuesPlays and monologuesPlays and monologuesMoreThe lobster and the wise guy vaudeville act and monologuefile_downloadDownloadcrop_originalOrder Printrate_reviewdescriptionSummarylabel_outlineTagsmusicpennsylvaniaphiladelphiafairmount parkfamily relationseconomic activitiestourismresort hotelstheatrical lifemonologuemedicinecurespatent medicinessongsdancesalomescriptlobsterguyvaudevilleactguy vaudeville acthigh resolutiondate_rangeDate01/01/1908personContributorsReynolds, Walter H.createSourceLibrary of CongresslinkLinkhttp://www.loc.gov/copyrightCopyright infoPublic Domain
